The domain within your query sequence starts at position 50 and ends at position 213; the E-value for the RSN1_TM domain shown below is 3.3e-24.
IPTVLLLDVSCFLFLILVFSIIRRRFWDYGRIALVSEAGSEARFQRLSSSSSGQQDFENE LGCCPWLTAIFRLHDDQILEWCGEDAIHYLSFQRHIIFLLVVISFLSLCVILPVNLSGDL LGKDPYSFGRTTIANLQTDNDLLWLHTVFSVIYLFLTVGFMWHH
RSN1_TM |
![]() |
---|
PFAM accession number: | PF13967 |
---|---|
Interpro abstract (IPR032880): | This entry represents the first three transmembrane regions of calcium permeable stress-gated cation channel 1 (Csc1). Csc1 is a cation channel that is permeable to calcium and gated by physical signals such as hyperosmotic stress [ (PUBMED:24503647) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RSN1_TM