The domain within your query sequence starts at position 65 and ends at position 183; the E-value for the RTP801_C domain shown below is 1.4e-46.
LSRSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRI VCDASVVPTFELTLVFKQESCPWTSLKDFFFSRGRFSSGLKRTLILSSGFRLVKKKLYS
RTP801_C |
---|
PFAM accession number: | PF07809 |
---|---|
Interpro abstract (IPR012918): | RTP801, also known as REDD1, is the protein product of a hypoxia-inducible factor 1 (HIF-1)- responsive gene and is thought to be involved in various cellular processes [ (PUBMED:11884613) ]. Both RTP801 and RTP801-like (REDD2) work downstream of AKT and upstream of TSC2 to inhibit mTOR, a serine/threonine kinase that plays an essential role in cell growth control [ (PUBMED:15632201) ]. Two members of this family expressed by Drosophila melanogaster, Scylla ( Q9NHN4 ) and Charybde ( Q9NHN5 ), are designated as Hox targets [ (PUBMED:11884613) (PUBMED:16423342) ]. |
GO process: | negative regulation of signal transduction (GO:0009968) |
GO component: | cytoplasm (GO:0005737) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RTP801_C