The domain within your query sequence starts at position 16 and ends at position 112; the E-value for the RTTN_N domain shown below is 1.2e-36.

EIRERALKSILCKIEHNLICYADLIQERLLFLHLLEWFNFPSVPMKEEVLNLLSRLVKYS
PAVQHLIDLGAVEFLSKLRPNVEPVIQAEIDGILDGL

RTTN_N

RTTN_N
PFAM accession number:PF14726
Interpro abstract (IPR029249):

Rotatin and its homologues such as Ana3 in Drosophila are found to be essential for centriole function [(PUBMED:11900971)]. A deficiency of rotatin in mice leads to randomised heart tube looping, defects in embryonic turning [(PUBMED:17551791)], and abnormal expression of HNF3beta, lefty, and nodal. Thus it is required for left-right and axial patterning. Ana3 - the Drosophila homologue - is present in centrioles and basal bodies, is required for the structural integrity of both centrioles and basal bodies and for centriole cohesion. Rotatin also localises to centrioles and basal bodies and appears to be essential for cilia function [(PUBMED:19948479)]. This entry represents the N-terminal domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RTTN_N