The domain within your query sequence starts at position 8 and ends at position 56; the E-value for the RWD domain shown below is 6.4e-8.

LVPEIDLKNAKGLSNESVNLLKSHLEELAKKQCGEVMIFELAHHVQSFL

RWD

RWD
PFAM accession number:PF05773
Interpro abstract (IPR006575):

The RWD domain is a conserved region of about 110 amino acid residues, which has been identified in the mouse GCN2 eIF2alpha kinase and histidyl-tRNA synthetase and in presumed orthologues in other eukaryotic species from yeast to vertebrates. Additionally, it is also found in WD repeat containing proteins, yeast DEAD (DEXD)-like helicases, many RING-finger containing proteins, the UPF0029 uncharacterised protein family and a range of hypothetical proteins. The RWD domain has been named after the better characterised RING finger and WD repeat containing proteins and DEAD-like helicases. It has been proposed that the RWD domain might have a function in protein interaction [(PUBMED:11779830)].

The RWD domain is predicted to have an alpha/beta secondary structure and is thought to be related to ubiquitin-conjugating enzymes (UBCc) domain, although the catalytic cysteine critical for ubiquitin-conjugating activity is not conserved in most members of the novel subfamily [(PUBMED:11779830)].

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RWD