The domain within your query sequence starts at position 451 and ends at position 655; the E-value for the RYDR_ITPR domain shown below is 3.5e-73.

SVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSS
AAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSG
ILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQH
LICDNLLPGRDLLLQTRLVNHVSSM

RYDR_ITPR

RYDR_ITPR
PFAM accession number:PF01365
Interpro abstract (IPR000699):

Ryanodine (RyR) and Inositol 1,4,5-trisphosphate (IP3) receptors are intracellular Ca2+-release channels. The RIH (RyR and IP3R Homology) domain is an extracellular domain from these two types of calcium channels. This domain may form a binding site for IP3 [(PUBMED:10664581)].

GO process:calcium ion transmembrane transport (GO:0070588)
GO component:membrane (GO:0016020)
GO function:calcium channel activity (GO:0005262)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RYDR_ITPR