The domain within your query sequence starts at position 460 and ends at position 655; the E-value for the RYDR_ITPR domain shown below is 1.2e-64.
LQTLQDLIAYFQPPEDEMQHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLNIYNSVA HFAGIVREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSNNLDWLISKLDRLESSSGIL EVLHCILIESPEALNLIAEGHIKSIISLLDKHGRNHKVLDVLCSLCLCNGVAVRANQNLI CDNLLPRRNLLLQTRL
RYDR_ITPR |
---|
PFAM accession number: | PF01365 |
---|---|
Interpro abstract (IPR000699): | Ryanodine (RyR) and Inositol 1,4,5-trisphosphate (IP3) receptors are intracellular Ca 2+ -release channels. The RIH (RyR and IP3R Homology) domain is an extracellular domain from these two types of calcium channels. This domain may form a binding site for IP3 [ (PUBMED:10664581) ]. |
GO process: | calcium ion transmembrane transport (GO:0070588) |
GO component: | membrane (GO:0016020) |
GO function: | calcium channel activity (GO:0005262) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RYDR_ITPR