The domain within your query sequence starts at position 69 and ends at position 167; the E-value for the Rab5-bind domain shown below is 6.9e-30.

ELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVA
QLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDSLDD

Rab5-bind

Rab5-bind
PFAM accession number:PF09311
Interpro abstract (IPR015390):

This domain is predominantly found in Rabaptin and allows for binding to the GTPase Rab5. This interaction is necessary and sufficient for Rab5-dependent recruitment of Rabaptin5 to early endosomal membranes [ (PUBMED:15378032) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rab5-bind