The domain within your query sequence starts at position 152 and ends at position 856; the E-value for the Rab_eff_C domain shown below is < 1e-12.

CFDILGGGLFEPNLENEGSISGSDSTFYRQSEGHSMMDTLAVALRVAEEAIEEAISKAES
HGDSLDKQNEASYLRDHKQELTEELAGTILQRIIRKQKDKAELRAEEEEPEWPRSQSGSV
KARGEGTTAPPGRHKARATFRRSQSAFSFTMEDALKSGSAEAAPRSPKDRAQRLLEEAAL
PSWRSMDGLDGTNLAPLLQSPDGNWMTLKDGSRQPPTRLLTKPKSGTFQALEVASSVTSA
YDEIGSDSEEDFDYSEALSKLCPPSQSRLKQPQPQPTQAQSSGQGPLATSPSNPEAMCSD
SETSSTSSSREAGCRAKLSWLQRKAPKNPAVEKMPLQGELDVNFNPQAAGGETSDSSDPE
ETLRTAERRARRWRRARVGPEESNRGLPSPGAHPRALHTAQVSDNVSETDISNETQNSRS
STDSVEEKLRNRLYELAMKMSEKETSSGEDQESESKAEPKNQKGSLSSEENNQGVQEELK
KKCSAVSLCNISTEVLKVINATEELIAESAGPWEIPPVSTDRENGMFPLGTDQVRLDKQL
TSLEENVYLAAGTVYGLEGQLSELEDAARCIHSSTGETELADLEDQVAAAAAQVHHAELQ
ISDIESRISALTIAGLNIAPCVRLTRRRDQKQRSQVQTIDTSRQQRRKLPAPPVKAEKIE
ASSVTPIKTFNRNFLLQGSSTNRPTASTGDTKDLMEPDLESAVMY

Rab_eff_C

Rab_eff_C
PFAM accession number:PF04698
Interpro abstract (IPR006788): This domain is found in Rab effector MyRIP and melanophilin. They are both Rab effector proteins involved in melanosome transport [(PUBMED:17827149), (PUBMED:11887186)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rab_eff_C