The domain within your query sequence starts at position 437 and ends at position 501; the E-value for the Rab_eff_C domain shown below is 1e-15.
GNPARPTKSTDEELSEMEDRVAMTASEVQQAESEISDIQSRIAALRAAGLTVKPSGKPRR KSGIP
Rab_eff_C |
---|
PFAM accession number: | PF04698 |
---|---|
Interpro abstract (IPR006788): | This domain is found in Rab effector MyRIP and melanophilin. They are both Rab effector proteins involved in melanosome transport [ (PUBMED:17827149) (PUBMED:11887186) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rab_eff_C