The domain within your query sequence starts at position 461 and ends at position 561; the E-value for the Rabaptin domain shown below is 2.9e-27.
QMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQK EVKKLQLMLRQANDQLEKTMKEKQELEDFLKQSAEDSSHQI
Rabaptin |
![]() |
---|
PFAM accession number: | PF03528 |
---|---|
Interpro abstract (IPR018514): | Regeneration of injured axons at neuromuscular junctions has been assumed to be regulated by extra-cellular factors that promote neurite outgrowth. A novel neurite outgrowth factor from chick denervated skeletal muscle has been cloned and characterised. The protein, termed neurocrescin (rabaptin), has been shown to be secreted in an activity-dependent fashion [ (PUBMED:9427343) ]. Rabaptin is a 100kDa coiled-coil protein that interacts with the GTP form of the small GTPase Rab5, a potent regulator of endocytic transport [ (PUBMED:8521472) ]. It is mainly cytosolic, but a fraction co-localises with Rab5 to early endosomes. Rab5 recruits rabaptin-5 to purified early endosomes in a GTP-dependent manner, demonstrating functional similarities with other members of the Ras superfamily. Immunodepletion of rabaptin-5 from cytosol strongly inhibits Rab5-dependent early endosome fusion. Thus, rabaptin-5 is a Rab effector required for membrane docking and fusion. |
GO function: | GTPase activator activity (GO:0005096), growth factor activity (GO:0008083) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rabaptin