The domain within your query sequence starts at position 536 and ends at position 590; the E-value for the Rad21_Rec8 domain shown below is 9.2e-23.

ANKELDFSSLVPPLSPRKLASRVFYLLLVLSTQKILLVEQQKPYGPLLIRPGPKF

Rad21_Rec8

Rad21_Rec8
PFAM accession number:PF04824
Interpro abstract (IPR006909): This domain represents a conserved C-terminal region found in eukaryotic cohesins of the Rad21, Rec8 and Scc1 families. Rad21/Rec8 like proteins mediate sister chromatid cohesion during mitosis and meiosis, as part of the cohesin complex [(PUBMED:11687503)]. Cohesion is necessary for homologous recombination (including double-strand break repair) and correct chromatid segregation. These proteins may also be involved in chromosome condensation. Dissociation at the metaphase to anaphase transition causes loss of cohesion and chromatid segregation [(PUBMED:10207075)].
GO component:nuclear chromosome (GO:0000228)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad21_Rec8