SMART: Pfam domain Rad4

The domain within your query sequence starts at position 485 and ends at position 619; the E-value for the Rad4 domain shown below is 6.4e-26.

CEPSSFPEASSSSSGCKRGKKVSSGAEEMADRKPAGVDQWLEVYCEPQAKWVCVDCVHGV
VGQPVACYKYATKPMTYVVGIDSDGWVRDVTQRYDPAWMTATRKCRVDAEWWAETLRPYR
SLLTEREKKEDQEFQ

Rad4

PFAM accession number:	PF03835
Interpro abstract (IPR018325):	RAD4/Xp-C proteins contain an ancient transglutaminase fold that is also found in peptide-N-glycanases (PNGases), which remove glycans from glycoproteins during their degradation. The PNGases retain the catalytic triad that is typical of this fold and are predicted to have a reaction mechanism similar to that involved in transglutamination. In contrast, the RAD4/Xp-C proteins are predicted to be inactive and are likely to only possess the interaction function in DNA repair [ (PUBMED:11487565) ].

PFAM accession number:

PF03835

Interpro abstract (IPR018325):

RAD4/Xp-C proteins contain an ancient transglutaminase fold that is also found in peptide-N-glycanases (PNGases), which remove glycans from glycoproteins during their degradation. The PNGases retain the catalytic triad that is typical of this fold and are predicted to have a reaction mechanism similar to that involved in transglutamination. In contrast, the RAD4/Xp-C proteins are predicted to be inactive and are likely to only possess the interaction function in DNA repair [ (PUBMED:11487565) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad4