The domain within your query sequence starts at position 64 and ends at position 249; the E-value for the Rad51 domain shown below is 3e-15.

FPLNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAAN
VAHSLQQNVLYVDSNGGMTASRLLQLLQARTQDEEKQASALQRIQVVRSFDIFRMLDMLQ
DLRGTIAQQVTNHLTRDWDGRRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLT
KSPRQP

Rad51

Rad51
PFAM accession number:PF08423
Interpro abstract (IPR013632):

This domain is found at the C terminus of DNA repair and recombination protein Rad51, and eukaryotic and archaeal Rad51-like proteins. It is critical for DNA binding [(PUBMED:15908697)]. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.

Unlike eubacteria, several archaeal species have two recA/RAD51-like genes, called RadA and RadB. Among eukaryotes, yeast contain four RAD51-like genes (RAD51, DMC1, RAD55/rhp55, and RAD57/rhp57). In vertebrate animals and plants, there are different RAD51-like genes: RAD51, RAD51B, RAD51C, RAD51D, DMC1, XRCC2, and XRCC3 [(PUBMED:16798872)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rad51