The domain within your query sequence starts at position 188 and ends at position 287; the E-value for the Radial_spoke domain shown below is 3e-18.

RELAIQNAKAYLLRTSMSCNLSLYEHLVNLLTKILNQRPEDPLSILESLNRTMQWEWFHP
KLDTLRDDPEMQPTYEMAEKQKALFIRGGGEGEQEMEEEV

Radial_spoke

Radial_spoke
PFAM accession number:PF04712
Interpro abstract (IPR006802): This family includes the radial spoke head proteins RSP4 and RSP6 from Chlamydomonas reinhardtii, and several eukaryotic homologues, including mammalian RSHL1, the protein product of a familial ciliary dyskinesia candidate gene [(PUBMED:11237735)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Radial_spoke