The domain within your query sequence starts at position 399 and ends at position 581; the E-value for the Radical_SAM domain shown below is 1.1e-29.

ATPSLACANKCVFCWRHHTNPVGTEWRWKMDQPELILKEAIENHQNMIKQFKGVPGLKAE
RFEEGMEVKHCALSLVGEPIMYPEINRLLKLLHQHGISSFLVTNAQFPEEIRKLTPVTQL
YVSVDASTRDGLKKIDRPLFKDFWQRFLDSLKALSAKQQRTVYRLTLVKCWNVDELQAYA
ELV

Radical_SAM

Radical_SAM
PFAM accession number:PF04055
Interpro abstract (IPR007197):

Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation. Evidence exists that these proteins generate a radical species by reductive cleavage of S:-adenosylmethionine (SAM) through an unusual Fe-S centre [(PUBMED:11222759), (PUBMED:15317939)].

GO function:catalytic activity (GO:0003824), iron-sulfur cluster binding (GO:0051536)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Radical_SAM