The domain within your query sequence starts at position 1 and ends at position 61; the E-value for the RasGAP domain shown below is 5.7e-7.
IEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAEHQANLRMCCELALCK V
RasGAP |
---|
PFAM accession number: | PF00616 |
---|---|
Interpro abstract (IPR001936): | This entry represents a conserved domain in the RasGAPs (Ras GTPase-activating proteins). This domain is also known as the RasGAP domain. Ras proteins are membrane-associated molecular switches that bind GTP and GDP and slowly hydrolyze GTP to GDP [ (PUBMED:1898771) ]. This intrinsic GTPase activity of Ras is regulated by a family of proteins collectively known as 'GAP' or GTPase-activating proteins [ (PUBMED:1883874) (PUBMED:7945277) ]. RasGAP proteins are usually quite large (from 765 residues for sar1 to 3079 residues for IRA2) but share only a limited (about 250 residues) region of sequence similarity, referred to as the 'catalytic domain' or RasGAP domain. The most conserved region within this domain contains a 15 residue motif which seems to be characteristic of this family of proteins [ (PUBMED:1883874) ]. Note: There are distinctly different GAPs for the rap and rho/rac subfamilies of Ras-like proteins (reviewed in reference [ (PUBMED:8259209) ]) that do not share sequence similarity with ras GAPs. |
GO process: | regulation of GTPase activity (GO:0043087) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RasGAP