The domain within your query sequence starts at position 1452 and ends at position 1580; the E-value for the RasGAP_C domain shown below is 4.5e-41.
LQEKKEKIQTGLKKLTELGTVDPKNRYQELINDIAKDIRNQRRYRQRRKAELVKLQQTYS ALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEK GVLLEIEDL
RasGAP_C |
---|
PFAM accession number: | PF03836 |
---|---|
Interpro abstract (IPR000593): | This domain can be found in the C terminus of the IQGAP family members, including human IQGAP1/2/3, S. cerevisiae Iqg1 and S. pombe Rng2. Some members function in cytoskeletal remodelling [ (PUBMED:20335501) ]. Human IQGAP1 is a scaffolding protein that can assemble multi-protein complexes involved in cell-cell interaction, cell adherence, and movement via actin/tubulin-based cytoskeletal reorganization [ (PUBMED:11112700) ]. IQGAP1 is also a regulator of the MAPK and Wnt/beta-catenin signaling pathways [ (PUBMED:20335501) ]. Iqg1 and Rng2 are required for actomyosin ring construction during cytokinesis [ (PUBMED:11854008) (PUBMED:9635188) ]. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RasGAP_C