The domain within your query sequence starts at position 1447 and ends at position 1903; the E-value for the Rav1p_C domain shown below is 4.2e-68.

DSTKKPQSYEDHIESQSEDQYSELFQVQEITTDDIDLEPEKRENKSKVINLSQYGPACFG
QEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDENRDKNYSGRDTLDECGL
RYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQW
SELRAMGIGWWVRNVNTLRRCIEKVAKAAFQRNNEALDAALFYLSMKKKAVVWGLFRSQH
DEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEVCLEKMED
IQLAMVIARLFESEFETSSTYISILNQKILGCQKDGTGFDCKRLHPDPFLRSLAYWVVKD
YTRALDTLLEQTPKEDDEQQVIIKSCNPVVFSFYNYLRTHPLLIRRNLASPEGTLATLGL
KTEKNIADKINLIERKLFFTTANAHFKVGCPVLALEV

Rav1p_C

Rav1p_C
PFAM accession number:PF12234
Interpro abstract (IPR022033):

This domain family is found in the C-terminal region of the protein Rav1 [(PUBMED:15090613)], a component of the RAVE (regulator of the ATPase of vacuolar and endosomal membranes) complex. Rav1p is involved in regulating the glucose dependent assembly and disassembly of vacuolar ATPase V1 and V0 subunits [(PUBMED:11844802)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rav1p_C