The domain within your query sequence starts at position 5 and ends at position 148; the E-value for the RbsD_FucU domain shown below is 1.3e-43.

KGIPKVLSPELLFALARMGHGDEIVLADANFPTSSICQCGPVEIRADGLDIPQLLEAVLR
LLPLDTYVESPAAVMDLVPSDKEKGLQTPIWKRYESLLLEADCKKTLMKLERFEFYERAK
KAFAVVATGEMALYGNIILKKGTL

RbsD_FucU

RbsD_FucU
PFAM accession number:PF05025
Interpro abstract (IPR007721):

RbsD is a component of the ribose operon. It was originally thought to be a high affinity ribose transport protein, but further analysis [ (PUBMED:16731978) ] shows that it is a D-ribose pyranase EC 5.5.1.n1 . It catalyzes the interconversion of beta-pyran and beta-furan forms of D-ribose. It also catalyzes the conversion between beta-allofuranose and beta-allopyranose.

FucU is a component of the fucose operon and is a L-fucose mutarotase EC 5.1.3.n2 involved in the anomeric conversion of L-fucose. It also exhibits a pyranase activity for D-ribose [ (PUBMED:16731978) ].

Both have been classified in the RbsD/FucU family of proteins. Members of this family are ubiquitous having been found in organisms from eubacteria to mammals.

GO process:monosaccharide metabolic process (GO:0005996)
GO function:isomerase activity (GO:0016853), monosaccharide binding (GO:0048029)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RbsD_FucU