The domain within your query sequence starts at position 737 and ends at position 778; the E-value for the Rbsn domain shown below is 6.5e-16.

LLLQQIDNIKAYIFDAKQCGRMDEVEVLTENLRELKCTLAKQ

Rbsn

Rbsn
PFAM accession number:PF11464
Interpro abstract (IPR021565):

Rabenosyn-5 (Rbsn) is a multivalent effector with interacts with the Rab family. Rsbn contains distinct Rab4 and Rab5 binding sites within residues 264-500 and 627-784 respectively [(PUBMED:16034420)]. Rab proteins are GTPases involved in the regulation of all stages of membrane trafficking [(PUBMED:16034420)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rbsn