The domain within your query sequence starts at position 1006 and ends at position 1078; the E-value for the RecQ_Zn_bind domain shown below is 1.5e-19.

YHDVTRLKRLIMMEKDGNYHTKETHVNNLYSMVHYCENITECRRIQLLAYFGEKGFNPDF
CKKYPDVSCDNCC

RecQ_Zn_bind

RecQ_Zn_bind
PFAM accession number:PF16124
Interpro abstract (IPR032284):

This domain is the zinc-binding domain of ATP-dependent DNA helicase RecQ [(PUBMED:14517231), (PUBMED:19151156)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RecQ_Zn_bind