The domain within your query sequence starts at position 835 and ends at position 905; the E-value for the RecQ_Zn_bind domain shown below is 2.2e-8.

PADFNTSRNLLIEIHDEKFRLYKLKMMVKMEKYLHSSQCRRRIILSHFEDKCLQKASLDI
MGTEKCCDNCR

RecQ_Zn_bind

RecQ_Zn_bind
PFAM accession number:PF16124
Interpro abstract (IPR032284):

This domain is the zinc-binding domain of ATP-dependent DNA helicase RecQ [(PUBMED:14517231), (PUBMED:19151156)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RecQ_Zn_bind