The domain within your query sequence starts at position 361 and ends at position 481; the E-value for the Recep_L_domain domain shown below is 1e-23.
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL F
Recep_L_domain |
---|
PFAM accession number: | PF01030 |
---|---|
Interpro abstract (IPR000494): | The structure for the first three domains of the extracellular portion of IGF-1R (type-1 insulin-like growth-factor receptor) has been solved and consists of two L-domains and a cysteine rich region (L1-Cys-rich-L2). The L-domains each consist of a single-stranded right-handed beta-helix. The Cys-rich region is composed of eight disulphide-bonded modules, seven of which form a rod-shaped domain with modules associated in an unusual manner. The three domains surround a central space of sufficient size to accommodate a ligand molecule [ (PUBMED:9690478) ]. This entry represents the L-domain. This domain can also be found in insulin receptor(IR) and epidermal growth-factor receptor (EGFR) family members, and in yeast cell surface GPI proteins PST1 and ECM33 [ (PUBMED:15583168) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Recep_L_domain