The domain within your query sequence starts at position 512 and ends at position 591; the E-value for the Reductase_C domain shown below is 9.4e-10.

YLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKSDEVIAVASMNYDPIVSKVA
EVLASGRAIRKREVETGDMS

Reductase_C

Reductase_C
PFAM accession number:PF14759
Interpro abstract (IPR028202):

This domain occurs at the C terminus of various reductase enzymes, including putidaredoxin reductase, ferredoxin reductase, 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component, benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit, rhodocoxin reductase, biphenyl dioxygenase system ferredoxin--NAD(+) reductase component, rubredoxin-NAD(+) reductase and toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component. In putidaredoxin reductase this domain is involved in dimerisation [(PUBMED:15095867)]. In the FAD-containing NADH-ferredoxin reductase (BphA4) it is responsible for interaction with the Rieske-type [2Fe-2S] ferredoxin (BphA3) [(PUBMED:17850818)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Reductase_C