The domain within your query sequence starts at position 40 and ends at position 172; the E-value for the Reeler domain shown below is 6.1e-24.

LCTHHGELEGDGEQGEVLISLHIAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSI
QSSQSIGGSSAFGFGIMSDHQFGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFM
ATATHRGQVIFKD

Reeler

Reeler
PFAM accession number:PF02014
Interpro abstract (IPR002861):

The reeler or reelin domain is a ~170 amino acid module, which has been identified in the amino terminus of the extracellular matrix proteins reelin and F-spondin (renamed Spon1) [(PUBMED:18602404), (PUBMED:19020352)]. The reelin domain is found in association with other modules, such as the thrombospondin type I repeat (TSP1), the spondin domain, the fibronectin type III domain or the Kunitz trypsin protease inhibitor domain. Its function is not yet known [(PUBMED:9441663), (PUBMED:10409509)].

Extracellular matrix (ECM) proteins play an important role in early cortical development, specifically in the formation of neural connections and in controlling the cyto-architecture of the central nervous system. The product of the reeler gene in mouse is reelin,a large extracellular protein secreted by pioneer neurons that coordinates cell positioning during neurodevelopment [(PUBMED:9338784)]. F-spondin and mindin are a family of matrix-attached adhesion molecules that share structural similarities and overlapping domains of expression. Both F-spondin and mindin promote adhesion and outgrowth of hippocampal embryonic neurons and bind to a putative receptor(s) expressed on both hippocampal and sensory neurons [(PUBMED:10409509)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Reeler