The domain within your query sequence starts at position 1 and ends at position 84; the E-value for the RelB_leu_zip domain shown below is 1.2e-43.

MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGLDGTQLSEMPR
LVPRGPASLSSVTLGPAAPPPPAT

RelB_leu_zip

RelB_leu_zip
PFAM accession number:PF16180
Interpro abstract (IPR032399):

This domain is a leucine zipper found in RelB transcription factors [(PUBMED:17869269)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RelB_leu_zip