The domain within your query sequence starts at position 381 and ends at position 558; the E-value for the RelB_transactiv domain shown below is 3.2e-98.

DSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFLDHFLPGHSSGLFLPPSALQP
ADSDFFPASISLPGLEPPGGPDLLDDGFAYDPSAPTLFTMLDLLPPAPPLASAVVGSGGA
GATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT

RelB_transactiv

RelB_transactiv
PFAM accession number:PF16181
Interpro abstract (IPR032400):

This domain is the transactivation domain of the transcription factor RelB [(PUBMED:17869269)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RelB_transactiv