The domain within your query sequence starts at position 5 and ends at position 93; the E-value for the Rep-A_N domain shown below is 7.2e-30.

LSEGAIEVMIQQENTSIKPILQVINIRPISTGNRSPRYRLLMSDGLNTLSSFMLATQLNT
LVEGGQLASNCVCQVHKFIVNTLKDGRMQ

Rep-A_N

Rep-A_N
PFAM accession number:PF04057
Interpro abstract (IPR007199):

Replication factor-a protein 1 (RPA1) forms a multiprotein complex with RPA2 and RPA3 that binds single-stranded DNA and functions in the recognition of DNA damage for nucleotide excision repair. The complex binds to single-stranded DNA sequences participating in DNA replication in addition to those mediating transcriptional repression and activation, and stimulates the activity of cognate strand exchange protein Sep1. It cooperates with T-AG and DNA topoisomerase I to unwind template DNA containing the Simian Virus 40 origin of replication [(PUBMED:7753855)].

GO process:DNA replication (GO:0006260)
GO component:nucleus (GO:0005634)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rep-A_N