The domain within your query sequence starts at position 5 and ends at position 113; the E-value for the Rep_fac-A_3 domain shown below is 2.5e-36.

MQLPKARVNASMLPQYIDRPVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEIS
GIVEVVGKVTAKATVLCASYTLFKEDTNRFDLELYNEAVKIINELPQFF

Rep_fac-A_3

Rep_fac-A_3
PFAM accession number:PF08661
Interpro abstract (IPR013970):

Rfa3 (also known as RPA14) is a component of the replication protein A (RPA) complex, which binds to and removes secondary structure from ssDNA. The RPA complex is involved in DNA replication, repair, and recombination [ (PUBMED:20012581) ].

GO process:DNA repair (GO:0006281), DNA replication (GO:0006260), DNA recombination (GO:0006310)
GO component:nucleus (GO:0005634)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rep_fac-A_3