The domain within your query sequence starts at position 253 and ends at position 445; the E-value for the Reprolysin_5 domain shown below is 2.7e-13.

YPRYVEVMVTADAKMVHHHGQNLQHYVLTLMSIVAAIYKDSSIGNLINIVIVKLVVIHSE
QEGPVISFNAATTLRNFCLWQQSQNVPDDAHPSHHDTAVLITREDICGAKEKCDTLGLAE
LGTLCDPSRSCSISEENGLSAAFTIAHELGHVFNVPHDDSFKCKEAGIKHQYHVMAPTLN
YHTSPWTWSACSQ

Reprolysin_5

Reprolysin_5
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Reprolysin_5