The domain within your query sequence starts at position 1 and ends at position 40; the E-value for the Requiem_N domain shown below is 8.9e-20.
XTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRR
Requiem_N |
---|
PFAM accession number: | PF14051 |
---|---|
Interpro abstract (IPR025750): | This putative domain has been detected on requiem/DPF family proteins. DPF2 interacts with estrogen related receptor alpha (Err-alpha), an orphan receptor which acts as a regulator in energy metabolism [ (PUBMED:20400511) ]. It was also identified as an adaptor molecule that links nuclear factor kappa-light-chain-enhancer of activated B cells (NF-kappa-B) dimer RelB/p52 and switch/sucrose-nonfermentable (SWI/SNF) chromatin remodeling factor [ (PUBMED:20460684) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Requiem_N