The domain within your query sequence starts at position 11 and ends at position 84; the E-value for the Requiem_N domain shown below is 2e-39.

LGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTHRGPGLAPGQI
YTYPARCWRKKRRL

Requiem_N

Requiem_N
PFAM accession number:PF14051
Interpro abstract (IPR025750):

This putative domain has been detected on requiem/DPF family proteins. DPF2 interacts with estrogen related receptor alpha (Err-alpha), an orphan receptor which acts as a regulator in energy metabolism [ (PUBMED:20400511) ]. It was also identified as an adaptor molecule that links nuclear factor kappa-light-chain-enhancer of activated B cells (NF-kappa-B) dimer RelB/p52 and switch/sucrose-nonfermentable (SWI/SNF) chromatin remodeling factor [ (PUBMED:20460684) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Requiem_N