The domain within your query sequence starts at position 20 and ends at position 185; the E-value for the Rer1 domain shown below is 4.1e-82.
RFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLF IAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMICTFFE AFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYK
Rer1 |
---|
PFAM accession number: | PF03248 |
---|---|
Interpro abstract (IPR004932): | RER1 family proteins are involved in the retrieval of some endoplasmic reticulum membrane proteins from the early golgi compartment. The C terminus of yeast Rer1p interacts with a coatomer complex [ (PUBMED:11238450) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rer1