The domain within your query sequence starts at position 20 and ends at position 185; the E-value for the Rer1 domain shown below is 4.1e-82.

RFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLF
IAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMICTFFE
AFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYK

Rer1

Rer1
PFAM accession number:PF03248
Interpro abstract (IPR004932):

RER1 family proteins are involved in the retrieval of some endoplasmic reticulum membrane proteins from the early golgi compartment. The C terminus of yeast Rer1p interacts with a coatomer complex [(PUBMED:11238450)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rer1