The domain within your query sequence starts at position 254 and ends at position 441; the E-value for the ResIII domain shown below is 2.4e-8.

LSALQLEAVTYAAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWF
SVSNDLKYDAERDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQ
SGGKYKTRLKQLLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKA
RVVYASAT

ResIII

ResIII
PFAM accession number:PF04851
Interpro abstract (IPR006935):

This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (EC 3.1.21.3), the Res subunit of type III endonucleases (EC 3.1.21.5), and the B subunit of excinuclease ABC (uvrB) [(PUBMED:11178902), (PUBMED:9628345), (PUBMED:16125908)].

GO function:ATP binding (GO:0005524), DNA binding (GO:0003677), hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ResIII