The domain within your query sequence starts at position 1 and ends at position 1255; the E-value for the Retinal domain shown below is < 1e-12.

MGCTPSHNVIVNSVAKSGIQFFKKPKAILPGCQWGSPKCPIPLLVQSSTFCDSGGELHLG
ERLVEETVSSSKKLQAMAEGVRQLPKAMEGLIPESQTFQVNKPQGHRATDISFRTEGSHG
TQEVDFSGKESKENTPQETSKGNRESVCHQPDSQDHCRQSATESKGRVDFPEPLVKAHQH
AYAYLHTSLSRYEAIVRLVQQASQTWGLLRPMLNFLLLCFEEAGQLLSEISKDGDVLLQE
VRGDLAWPLRKGEPWEQHPDLLQQLLQYTVSKLRALHGTVAALTGSFLEGSSSCLRSTAG
HLEGKLSTKRGIDECLLRALGQLESLTSSHGDAGLLGPPLCSEDSGIGADNESVHSVEKL
GKQASWDFAAELGEWKPGTAAQVEARPSGHAWQEGPYWTGSDRPQDCPLSSPRIAKVQPA
VQDEARSASTSGAGAEAVTSGPSEAAESLPWDSLGAEIPVRTPLSRSSGLTDAPSLSEEE
DCSPEEEDELSSTDLHPEPQKALPSRPRSSPDTRESLFQPYSKELRNPQAQEMILKMKEA
ISERIKFVPEPSRPQDWTEEEEGGTVVPPRPRSVSGSRGGPERQRRSQSEGCLKSHVEDP
TLQELRRVQTDLSRRLEVFYALGATRQGQSRERCLPSRASVLWPPTNCRVSPSSAISKFK
ASLTQNFSILPNQDKSIFQKGSPCFDGEQPCQGKAEKLPNAIFCGKKSGRAPRDNERDIR
ACPTRPSVKTLIETFSPTESLRMPRNCRNLGSSPCLRKWGVPAMPPRFPIYRGLAPLYSK
PQISPAAGWRPSAPFPSLPLAEVSESEDISGDVEEDLENLPPPPLEVLMDKSFAALECPE
CSQPAGSSLEETLLPGLQEASHPKRTWVSPRLKASMSPMDLLPSKGSGSSPRLHSTRSGS
TRIVGDSRKLTLDLNSKQTASPSSEAKSRAQIQARAETIAGFSKQHQKAIPWHHTNPTPG
QSRTLEPSLARFSRDPHSSEASRKGPERSLPRVRKASPQRAQWASQGDRRLQSLPSSHGP
SQPGLPAVLSSPSPPLSPRTLSPPATRKTTSPPCQHPQSNPAPGSPPVRRTETNTPSSAS
CSSPSVSPSRGSKDSIHSEDSEATTAKASRNTCSIFYPAATSLFEAKSSSSTSHPQMLPE
PGGLLRTPTGGWRGSSGQRLRADSQKRTVLNALNPLPFVRRTASDRQRQQGDQLQQSRSD
WEFHSCQNSSSSSSSEENPKQELPPWNNSRVPELQGSSTKRASPLELCVLGHGLQ

Retinal

Retinal
PFAM accession number:PF15449
Interpro abstract (IPR029352):

This entry represents the protein encoded by the C2ORF71 gene [(PUBMED:20398884), (PUBMED:20398886)]. Mutations of C2ORF71 has been associated with autosomal recessive (AR) retinitis pigmentosa (RP) in humans and with visual defects in zebrafish [(PUBMED:20811058), (PUBMED:22686255)]. The function of this family of proteins is unknown, but it is predominately expressed in the photoreceptors and is likely to be important in the development and function of the retina.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Retinal