The domain within your query sequence starts at position 182 and ends at position 332; the E-value for the Rgp1 domain shown below is 1.2e-41.

LEEDDSGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVG
TLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGTGVAPSVSHVTHARHQESCLHTTRTSF
SLPIPLCSTPGFCTAIVSLKWRLHFEFVTSR

Rgp1

Rgp1
PFAM accession number:PF08737
Interpro abstract (IPR014848):

Rgp1 forms heterodimer with Ric1 (IPR009771) which associates with Golgi membranes and functions as a guanyl-nucleotide exchange factor [(PUBMED:10990452)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rgp1