The domain within your query sequence starts at position 37 and ends at position 92; the E-value for the RhoGAP domain shown below is 5.9e-11.

PQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRHEFDSEHVPDLTKEPYVQDIH

RhoGAP

RhoGAP
PFAM accession number:PF00620
Interpro abstract (IPR000198): Members of the Rho family of small G proteins transduce signals from plasma-membrane receptors and control cell adhesion, motility and shape by actin cytoskeleton formation. Like all other GTPases, Rho proteins act as molecular switches, with an active GTP-bound form and an inactive GDP-bound form. The active conformation is promoted by guanine-nucleotide exchange factors, and the inactive state by GTPase-activating proteins (GAPs) which stimulate the intrinsic GTPase activity of small G proteins. This entry is a Rho/Rac/Cdc42-like GAP domain, that is found in a wide variety of large, multi-functional proteins [(PUBMED:9009196)]. A number of structure are known for this family [(PUBMED:9009196), (PUBMED:8962058), (PUBMED:9262406)]. The domain is composed of seven alpha helices. This domain is also known as the breakpoint cluster region-homology (BH) domain.
GO process:signal transduction (GO:0007165)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RhoGAP