The domain within your query sequence starts at position 11 and ends at position 201; the E-value for the Rho_GDI domain shown below is 4.6e-85.
LAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNV IVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQ HTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYNIKSRFTDDDKTDHL SWEWNLTIKKE
Rho_GDI |
---|
PFAM accession number: | PF02115 |
---|---|
Interpro abstract (IPR000406): | The GDP dissociation inhibitor for rho proteins, rho GDI, regulates GDP/GTP exchange by inhibiting the dissociation of GDP from them. The protein contains 204 amino acids, with a calculated Mr value of 23,421. Hydropathy analysis shows it to be largely hydrophilic, with a single hydrophobic region. Results of database searches suggest rho GDI is a novel protein, currently with no known homologue. The protein plays an important role in the activation of the superoxide (O2-)-generating NADPH oxidase of phagocytes. This process requires the interaction of membrane-associated cytochrome b559 with 3 cytosolic components: p47-phox, p67-phox and a heterodimer of the small G-protein p21rac1 and rho GDI [ (PUBMED:8223583) ]. The association of p21rac and GDI inhibits dissociation of GDP from p21rac, thereby maintaining it in an inactive form. The proteins are attached via a lipid tail on p21rac that binds to the hydrophobic region of GDI [ (PUBMED:8796870) ]. Dissociation of these proteins might be mediated by the release of lipids (e.g., arachidonate and phosphatidate) from membranes through the action of phospholipases [ (PUBMED:8796870) ]. The lipids may then compete with the lipid tail on p21rac for the hydrophobic pocket on GDI. |
GO component: | cytoplasm (GO:0005737) |
GO function: | Rho GDP-dissociation inhibitor activity (GO:0005094) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rho_GDI