The domain within your query sequence starts at position 91 and ends at position 155; the E-value for the Rhomboid_SP domain shown below is 7.1e-31.

VSKDSDSTQKWQRKSIRHCSQRYGKLKPQVIRELDLPSQDNVSLTSTETPPPLYVGPCQL
GMQKL

Rhomboid_SP

Rhomboid_SP
PFAM accession number:PF12595
Interpro abstract (IPR022241):

This domain family is found in eukaryotes, and is approximately 210 amino acids in length. The family is found in association with . Rhomboid is a seven-transmembrane spanning protein that resides in the Golgi and acts as a serine protease to cleave Spitz.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rhomboid_SP