The domain within your query sequence starts at position 120 and ends at position 294; the E-value for the Rib_5-P_isom_A domain shown below is 7.3e-65.

ICIPTSFQARQLILQYGLTLSDLDQHPEIDLAIDGADEVDAELNLIKGGGGCLTQEKIVA
GYASRFIVIADFRKDSKNLGDRWHKGIPIEVIPMAYVPVSRAVAQKFGGEVELRMAVNKA
GPVVTDNGNFILDWKFDRVHKWSEVNTAIKMTPGVVDTGLFINMAERVYFGMQDG

Rib_5-P_isom_A

• PFAM accession number: PF06026
• Interpro abstract (IPR004788):

  Ribose 5-phosphate isomerase, also known as phosphoriboisomerase, catalyses the reversible conversion of D-ribose 5-phosphate to D-ribulose 5-phosphate, the first step in the non-oxidative branch of the pentose phosphate pathway [ (PUBMED:12517338) ]. This reaction enables ribose to be synthesized from sugars, as well as the recycling of sugars during the degradation of nucleotides. There are two unrelated types of ribose 5-phosphate isomerases: type A (RpiA) is the most common and is found in most organisms, while type B (RpiB) is restricted to specific eukaryotic and prokaryotic species. Escherichia coli produces both RpiA and RpiB (also known as AlsB), although RpiA accounts for 99% of total RPI enzymes [ (PUBMED:12211039) ].

  This entry represents type A (RpiA) enzymes found in eukaryotes (plants, Metazoa and fungi), bacteria and archaea.

• GO process: pentose-phosphate shunt, non-oxidative branch (GO:0009052)
• GO function: ribose-5-phosphate isomerase activity (GO:0004751)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rib_5-P_isom_A