The domain within your query sequence starts at position 33 and ends at position 173; the E-value for the Rib_recp_KP_reg domain shown below is 2.8e-47.

MKETSYEEALANQRKEMAKTHHQKGEKKKKEKTVEKKGKTKKKEEKPNGKIPEHDLDPNV
TIILKEPVRVSAVAVAPTSVHSSVGHTPIATVPAMPQEKLASSPKDRKKKEKKVAKVEPA
VSSIVNSIQVLASKSAILEAT

Rib_recp_KP_reg

Rib_recp_KP_reg
PFAM accession number:PF05104
Interpro abstract (IPR007794): The ribosome receptor is an integral endoplasmic reticulum protein that has been suggested to be involved in secretion. This highly conserved region is found towards the C terminus of the transmembrane domain [(PUBMED:11836413)]. The function is unclear.
GO process:protein transport (GO:0015031)
GO component:integral component of endoplasmic reticulum membrane (GO:0030176)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Rib_recp_KP_reg