The domain within your query sequence starts at position 2 and ends at position 71; the E-value for the Ribophorin_II domain shown below is 1.5e-15.

APPGSSAVFLLALTITASVQALTPTHYLTKQDVERLKASLDRPFTDLESAFYSIVGLSSL
GVQVPDVKIS

Ribophorin_II

Ribophorin_II
PFAM accession number:PF05817
Interpro abstract (IPR008814):

Swp1 is an essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyses the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains [(PUBMED:8175708)]. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity [(PUBMED:15831493)].

GO process:protein N-linked glycosylation (GO:0006487)
GO component:integral component of membrane (GO:0016021), oligosaccharyltransferase complex (GO:0008250)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribophorin_II