The domain within your query sequence starts at position 3 and ends at position 146; the E-value for the Ribosomal_L19e domain shown below is 3e-72.
MLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRAR CRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHS LYLKVKGNVFKNKRILMEHIHKLK
Ribosomal_L19e |
---|
PFAM accession number: | PF01280 |
---|---|
Interpro abstract (IPR000196): | This entry represents ribosomal protein L19 from eukaryotes, as well as L19e from archaea [ (PUBMED:10381320) ]. L19/L19e is part of the large ribosomal subunit, whose structure has been determined in a number of eukaryotic and archaeal species [ (PUBMED:15184028) ]. |
GO process: | translation (GO:0006412) |
GO component: | ribosome (GO:0005840) |
GO function: | structural constituent of ribosome (GO:0003735) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_L19e