The domain within your query sequence starts at position 99 and ends at position 192; the E-value for the Ribosomal_L21p domain shown below is 6e-22.

LFAVVHFASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELV
RVEATVIEKTESWPKINMKFRKRKNFRKKKNTDP

Ribosomal_L21p

Ribosomal_L21p
PFAM accession number:PF00829
Interpro abstract (IPR028909): This entry represents large ribosomal subunit protein L21 and mitochondrial ribosomal subunit from yeast L49 (Mrpl49). In S. pombe, the putative mitochondrial ribosomal protein bL21 (Mrpl49) is fused to aconitase [(PUBMED:25724335)]. L21 has a small beta-barrel-like domain that is connected to an extended loop [(PUBMED:11733066)].

In Escherichia coli, L21 is known to bind to the 23S rRNA in the presence of L20. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities, groups:

  • Bacterial L21.
  • Marchantia polymorpha chloroplast L21.
  • Cyanelle L21.
  • Plant chloroplast L21 (nuclear-encoded).

Bacterial L21 is a protein of about 100 amino-acid residues, the mature form of the spinach chloroplast L21 has 200 residues.

GO component:ribosome (GO:0005840)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_L21p