The domain within your query sequence starts at position 99 and ends at position 197; the E-value for the Ribosomal_L21p domain shown below is 7.5e-25.
LFAVVHFASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELV RVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTIL
Ribosomal_L21p |
---|
PFAM accession number: | PF00829 |
---|---|
Interpro abstract (IPR028909): | In Escherichia coli, L21 is known to bind to the 23S rRNA in the presence of L20. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities, groups:
Bacterial L21 is a protein of about 100 amino-acid residues, the mature form of the spinach chloroplast L21 has 200 residues. This entry represents large ribosomal subunit protein L21 and mitochondrial ribosomal subunit from yeast L49 (Mrpl49). In S. pombe, the putative mitochondrial ribosomal protein bL21 (Mrpl49) is fused to aconitase [ (PUBMED:25724335) ]. L21 has a small beta-barrel-like domain that is connected to an extended loop [ (PUBMED:11733066) ]. |
GO component: | ribosome (GO:0005840) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_L21p