The domain within your query sequence starts at position 75 and ends at position 144; the E-value for the Ribosomal_S17 domain shown below is 1.4e-32.
GVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGECRPL SKTVRFNVLK
Ribosomal_S17 |
 |
|---|
| PFAM accession number: | PF00366 |
|---|---|
| Interpro abstract (IPR000266): | The ribosomal proteins catalyse ribosome assembly and stabilise the rRNA, tuning the structure of the ribosome for optimal function. Evidence suggests that, in prokaryotes, the peptidyl transferase reaction is performed by the large subunit 23S rRNA, whereas proteins probably have a greater role in eukaryotic ribosomes. Most of the proteins lie close to, or on the surface of, the 30S subunit, arranged peripherally around the rRNA [ (PUBMED:9281425) ]. The small subunit ribosomal proteins can be categorised as primary binding proteins, which bind directly and independently to 16S rRNA; secondary binding proteins, which display no specific affinity for 16S rRNA, but its assembly is contingent upon the presence of one or more primary binding proteins; and tertiary binding proteins, which require the presence of one or more secondary binding proteins and sometimes other tertiary binding proteins. The small ribosomal subunit protein S17 is known to bind specifically to the 5' end of 16S ribosomal RNA in Escherichia coli (primary rRNA binding protein), and is thought to be involved in the recognition of termination codons. Experimental evidence [ (PUBMED:9371771) ] has revealed that S17 has virtually no groups exposed on the ribosomal surface. This ribosomal protein family includes 30S ribosomal protein S17 and 40S ribosomal protein S11. |
| GO process: | translation (GO:0006412) |
| GO component: | ribosome (GO:0005840) |
| GO function: | structural constituent of ribosome (GO:0003735) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_S17