The domain within your query sequence starts at position 5 and ends at position 73; the E-value for the Ribosomal_S17_N domain shown below is 1.9e-40.

QTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTG
NVSIRGRIL

Ribosomal_S17_N

Ribosomal_S17_N
PFAM accession number:PF16205
Interpro abstract (IPR032440):

This short N-terminal region is found in a number of eukaryotic ribosomal subunit 11 proteins [(PUBMED:8093055)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_S17_N