The domain within your query sequence starts at position 184 and ends at position 257; the E-value for the Ribosomal_S5_C domain shown below is 1.3e-24.

VTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDA
ISKTYSYLTPDLWK

Ribosomal_S5_C

Ribosomal_S5_C
PFAM accession number:PF03719
Interpro abstract (IPR005324):

This entry represents the C-terminal of the ribosomal protein S5, which is related to the 30S ribosomal protein S5P from Sulfolobus acidocaldarius (O05641). Ribosomal protein S5 is one of the proteins from the small ribosomal subunit. In Escherichia coli, S5 is known to be important in the assembly and function of the 30S ribosomal subunit. Mutations in S5 have been shown to increase translational error frequencies.

GO process:translation (GO:0006412)
GO component:ribosome (GO:0005840)
GO function:structural constituent of ribosome (GO:0003735)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ribosomal_S5_C