The domain within your query sequence starts at position 66 and ends at position 505; the E-value for the Ric8 domain shown below is 2.3e-125.

WLQTIRILSRDRSCLDSFASRQSLHALACYADITVSEEPIPQSPDMDVLLESLKCLCNLV
LSSPTAQMLAAEARLVVRLAERVGLYRKRSYPHEVQFFDLRLLFLLTALRTDVRQQLFQE
LHGVRLLTDALELTLGVAPKENPPVMLPAQETERAMEILKVLFNITFDSVKREVDEEDAA
LYRYLGTLLRHCVMVEAAGDRTEEFHGHTVNLLGNLPLKCLDVLLALELHEGSLEFMGVN
MDVISALLAFLEKRLHQTHRLKECVAPVLNVLTECARMHRPARKFLKAQVLPPLRDVRTR
PEVGDLLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLM
AGGRPEGQYSEDEDTDTEEYREAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVNM
FDKLSRHRVIQPMGMSPRGH

Ric8

Ric8
PFAM accession number:PF10165
Interpro abstract (IPR019318):

Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [(PUBMED:10985349)]. It is a guanine nucleotide exchange factor [(PUBMED:12971991)] that regulates neurotransmitter secretion.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ric8